Product Description
CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing rolesin vivo: 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor. Recombinant CD164 protein may serve as coating matrix protein for studying of hematopoietic stem cell (HSC) functionsin vitro.
Full-length of human CD164 extracellular domain cDNA (24 – 162 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.
The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.
| Parameter, Testing, and Method | CD164 #5100 |
| Quantity | 0.05 mg |
| Volume | 0.1 mL |
| Concentration | 0.5 mg/mL |
| Purity - SDS PAGE Electrophoresis | > 90% |
| Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
| Form | Solution |
| Production Type | Recombinant - E. Coli |
| Storage Temperature | -20°C |
| Shelf Life | Minimum of 6 months from date of receipt |
| Sterilization Method | Filtration |
| Cell Assay | Pass |
| Sterility- USP modified | No Growth |
| Accession Number | NP_006007 |
| Recombinant Protein Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD |
Directions for Use
Download the full PDF version or continue reading below:
Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.
- Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly. Note: Use 1 ml PBS perwell in a 6-well plate.
- Add 1 – 10 µg protein to each well and incubate at 2 to 10°C overnight.
- After incubation, aspirate remaining material.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant matrix protein at 1-10 ug / well (6 well plate) in HSC cell specific medium can be used for human HSC / receptor interaction studyin vitro.
Product Certificate of Analysis
Safety and Documentation
Safety Data Sheet
Certificate of Origin
Product Disclaimer
This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.
