Product Description
Human CD40 (TNRRSF5: tumor necrosis factor receptor superfamily member 5, isoform 2) is a 203 amino acid cell surface protein. This protein belongs to a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
| Parameter, Testing, and Method | CD40 #5093 |
| Quantity | 0.1 mg |
| Volume | 0.2 mL |
| Concentration | 0.5 mg/mL |
| Purity - SDS PAGE Electrophoresis | > 90% |
| Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
| Form | Solution |
| Production Type | Recombinant - E. Coli |
| Storage Temperature | -20°C |
| Shelf Life | Minimum of 6 months from date of receipt |
| Sterilization Method | Filtration |
| Cell Assay | Pass |
| Sterility- USP modified | No Growth |
| Accession Number | NP_690593 |
| Recombinant Protein Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFELEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHHLRDPVCHPLGAGL |
Directions for Use
Download the full PDF version or continue reading below:
Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.
- Thaw CD40 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly. Note: Coating this recombinant protein at 1-10 µg / well (6 well plate) in T cell specific medium can be used for study of human B and T cell / Receptor or as culture matrix protein for human B cells culturein vitro.
- Add appropriate amount of diluted material to culture surface.
- Incubate at room temperature for approximately 1 – 2 hours.
- Aspirate remaining material.
- Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Product Certificate of Analysis
Safety and Documentation
Safety Data Sheet
Certificate of Origin
Product Disclaimer
This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.
