
Product Description
Human CD14 (monocyte differentiation antigen CD14) is a 375 amino acid, phospholipid anchored cell surface protein. This protein is preferentially expressed on monocytes / macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide.
Full-length extracellular domain of human CD14 gene (20-345 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies.
Parameter, Testing, and Method | CD14 #5089 |
Quantity | 0.1 mg |
Volume | 0.2 mL |
Concentration | 0.5 mg/mL |
Purity - SDS PAGE Electrophoresis | > 90% |
Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
Form | Solution |
Production Type | Recombinant - E. Coli |
Storage Temperature | -20°C |
Shelf Life | Minimum of 6 months from date of receipt |
Sterilization Method | Filtration |
Cell Assay | Pass |
Sterility- USP modified | No Growth |
Accession Number | NP_000582 |
Recombinant Protein Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGTTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN |
Poduct was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Directions for Use
Download the full PDF version or continue reading below:
Use these recommendations as guidelines to determine the optimal coating conditions for your culture system.
- Thaw CD14 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so that the volume added covers the surface evenly.
- Add appropriate amount of diluted material to culture surface.
- Incubate at room temperature for approximately 1 – 2 hours.
- Aspirate remaining material.
- Rinse plates carefully with dH2O– avoid scratching bottom surface of plates.
- Plates are ready for use. They may also be stored at 2-8°C damp or air dried if sterility is maintained.
Coating this recombinant protein at 1-10 ug / well (6 well plate) in T cell specific medium can be used for 1) human T cell / receptor interaction studyin vitroor 2) as a breast cancer biomarker for diagnosis application when combined with CD16 antigen.
Product Certificate of Analysis
Safety and Documentation
Safety Data Sheet
Certificate of Origin
Product Disclaimer
This product is for R&D use only and is not intended for human or other uses. Please consult the Material Safety Data Sheet for information regarding hazards and safe handling practices.